SLC39A9/ZIP9 Antibody

Name SLC39A9/ZIP9 Antibody
Supplier Novus Biologicals
Catalog NBP1-59841
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Bovine, Dog, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to SLC39A9 (solute carrier family 39 (zinc transporter), member 9) The peptide sequence was selected from the middle region of SLC39A9)(50ug). Peptide sequence YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLV
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLC39A9
Supplier Page Shop

Product images