beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody

Name beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59837
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to B4GALT2 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2) The peptide sequence was selected from the middle region of B4GALT2. Peptide sequence AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISL
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene B4GALT2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.