FAM105A Antibody

Name FAM105A Antibody
Supplier Novus Biologicals
Catalog NBP1-59835
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM105A (family with sequence similarity 105, member A) The peptide sequence was selected from the N terminal of FAM105A. Peptide sequence HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM105A
Conjugate Unconjugated
Supplier Page Shop

Product images