ATP1B4 Antibody

Name ATP1B4 Antibody
Supplier Novus Biologicals
Catalog NBP1-59867
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATP1B4(ATPase, (Na+)/K+ transporting, beta 4 polypeptide) The peptide sequence was selected from the middle region of ATP1B4. Peptide sequence ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ATP1B4
Conjugate Unconjugated
Supplier Page Shop

Product images