Name | AE2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59858 |
Prices | $139.00, $369.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC4A2(solute carrier family 4, anion exchanger, member 2) Antibody(against the N terminal of SLC4A2 (NP_003031). Peptide sequence MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC4A2 |
Conjugate | Unconjugated |
Supplier Page | Shop |