AE2 Antibody

Name AE2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59858
Prices $139.00, $369.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC4A2(solute carrier family 4, anion exchanger, member 2) Antibody(against the N terminal of SLC4A2 (NP_003031). Peptide sequence MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC4A2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.