Name | SLC35F5 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59894 |
Prices | $299.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to SLC35F5(solute carrier family 35, member F5) The peptide sequence was selected from the C terminal of SLC35F5. Peptide sequence VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLMCI. |
Purity/Format | IgG purified |
Description | Rabbit Polyclonal |
Gene | SLC35F5 |
Supplier Page | Shop |