SLC35F5 Antibody

Name SLC35F5 Antibody
Supplier Novus Biologicals
Catalog NBP1-59894
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to SLC35F5(solute carrier family 35, member F5) The peptide sequence was selected from the C terminal of SLC35F5. Peptide sequence VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLMCI.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene SLC35F5
Supplier Page Shop

Product images