SLC12A8 Antibody

Name SLC12A8 Antibody
Supplier Novus Biologicals
Catalog NBP1-59893
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to SLC12A8(solute carrier family 12 (potassium/chloride transporters), member 8) The peptide sequence was selected from the N terminal of SLC12A8. Peptide sequence IIRLQLLLLFLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQ
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLC12A8
Supplier Page Shop

Product images