SLC38A5 Antibody

Name SLC38A5 Antibody
Supplier Novus Biologicals
Catalog NBP1-59895
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC38A5(solute carrier family 38, member 5) The peptide sequence was selected from the N terminal of SLC38A5. Peptide sequence GIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC38A5
Conjugate Unconjugated
Supplier Page Shop

Product images