YIF1B Antibody
| Name | YIF1B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59926 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to YIF1B(Yip1 interacting factor homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of YIF1B. Peptide sequence LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | YIF1B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: YIF1B Antibody [NBP1-59926] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7390_YIF1B%2520Antibody-Western%2520Blot-NBP1-59926-img0003.jpg)
![Western Blot: YIF1B Antibody [NBP1-59926] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7391_YIF1B-Antibody-Western-Blot-NBP1-59926-img0002.jpg)