DPP6 Antibody

Name DPP6 Antibody
Supplier Novus Biologicals
Catalog NBP1-59925
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DPP6(dipeptidyl-peptidase 6) The peptide sequence was selected from the middle region of DPP6. Peptide sequence AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DPP6
Conjugate Unconjugated
Supplier Page Shop

Product images