WDR33 Antibody
| Name | WDR33 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60030 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to WDR33(WD repeat domain 33) The peptide sequence was selected from the middle region of WDR33. Peptide sequence TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | WDR33 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: WDR33 Antibody [NBP1-60030] - Human HepG2, Antibody Dilution: 1.0 ug/ml WDR33 is supported by BioGPS gene expression data to be expressed in HepG2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24560_WDR33-Antibody-Western-Blot-NBP1-60030-img0003.jpg)
Western Blot: WDR33 Antibody [NBP1-60030] - Human HepG2, Antibody Dilution: 1.0 ug/ml WDR33 is supported by BioGPS gene expression data to be expressed in HepG2.
![Western Blot: WDR33 Antibody [NBP1-60030] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24561_WDR33-Antibody-Western-Blot-NBP1-60030-img0002.jpg)
Western Blot: WDR33 Antibody [NBP1-60030] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: WDR33 Antibody [NBP1-60030] - Lanes: 1 : SREC pulldown from lysate from 10^6 human 293T cells Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-Alexa Fluor Secondary, Antibody Dilution: 1 : 5000 Gene name: WDR33.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24562_WDR33%2520Antibody-Western%2520Blot-NBP1-60030-img0004.jpg)
Western Blot: WDR33 Antibody [NBP1-60030] - Lanes: 1 : SREC pulldown from lysate from 10^6 human 293T cells Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-Alexa Fluor Secondary, Antibody Dilution: 1 : 5000 Gene name: WDR33.