Tyrosylprotein Sulfotransferase 2/TPST2 Antibody

Name Tyrosylprotein Sulfotransferase 2/TPST2 Antibody
Supplier Novus Biologicals
Catalog NBP1-60025
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Rabbit
Antigen Synthetic peptides corresponding to TPST2(tyrosylprotein sulfotransferase 2) The peptide sequence was selected from the middle region of TPST2. Peptide sequence KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene TPST2
Supplier Page Shop

Product images