Name | Tyrosylprotein Sulfotransferase 2/TPST2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-60025 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Rabbit |
Antigen | Synthetic peptides corresponding to TPST2(tyrosylprotein sulfotransferase 2) The peptide sequence was selected from the middle region of TPST2. Peptide sequence KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | TPST2 |
Supplier Page | Shop |