GLUT12 Antibody

Name GLUT12 Antibody
Supplier Novus Biologicals
Catalog NBP1-60023
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC2A12(solute carrier family 2 (facilitated glucose transporter), member 12) The peptide sequence was selected from the middle region of SLC2A12. Peptide sequence FFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGVGV
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC2A12
Conjugate Unconjugated
Supplier Page Shop

Product images