TMEM126B Antibody

Name TMEM126B Antibody
Supplier Novus Biologicals
Catalog NBP1-59978
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMEM126B(transmembrane protein 126B) The peptide sequence was selected from the middle region of TMEM126B. Peptide sequence VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene TMEM126B
Conjugate Unconjugated
Supplier Page Shop

Product images