C17orf80 Antibody

Name C17orf80 Antibody
Supplier Novus Biologicals
Catalog NBP1-59973
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to C17ORF80 The peptide sequence was selected from the N terminal of C17ORF80. Peptide sequence MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene C17orf80
Supplier Page Shop

Product images