FAM70A Antibody

Name FAM70A Antibody
Supplier Novus Biologicals
Catalog NBP1-59972
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM70A(family with sequence similarity 70, member A) The peptide sequence was selected from the N terminal of FAM70A. Peptide sequence IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TMEM255A
Conjugate Unconjugated
Supplier Page Shop

Product images