LAPTM4A Antibody

Name LAPTM4A Antibody
Supplier Novus Biologicals
Catalog NBP1-59964
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LAPTM4A(lysosomal-associated protein transmembrane 4 alpha) The peptide sequence was selected from the middle region of LAPTM4A (NP_055528). Peptide sequence VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene LAPTM4A
Conjugate Unconjugated
Supplier Page Shop

Product images