Name | LAPTM4A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59964 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to LAPTM4A(lysosomal-associated protein transmembrane 4 alpha) The peptide sequence was selected from the middle region of LAPTM4A (NP_055528). Peptide sequence VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | LAPTM4A |
Conjugate | Unconjugated |
Supplier Page | Shop |