TRAM2 Antibody

Name TRAM2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59957
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRAM2(translocation associated membrane protein 2) The peptide sequence was selected from the N terminal of TRAM2. Peptide sequence MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRAM2
Conjugate Unconjugated
Supplier Page Shop

Product images