UNC5H1/Unc5a Antibody

Name UNC5H1/Unc5a Antibody
Supplier Novus Biologicals
Catalog NBP1-60033
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to UNC5A(unc-5 homolog A (C. elegans)) The peptide sequence was selected from the middle region of UNC5A. Peptide sequence VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene UNC5A
Supplier Page Shop

Product images