Name | UNC5H1/Unc5a Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-60033 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to UNC5A(unc-5 homolog A (C. elegans)) The peptide sequence was selected from the middle region of UNC5A. Peptide sequence VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | UNC5A |
Supplier Page | Shop |