Name | Claudin-18 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-60009 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CLDN18(claudin 18) The peptide sequence was selected from the middle region of CLDN18. Peptide sequence LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CLDN18 |
Conjugate | Unconjugated |
Supplier Page | Shop |