SPNS1 Antibody

Name SPNS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59999
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SPNS1(spinster homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of SPNS1. Peptide sequence AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRIT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SPNS1
Conjugate Unconjugated
Supplier Page Shop

Product images