ACBD4 Antibody

Name ACBD4 Antibody
Supplier Novus Biologicals
Catalog NBP1-59995
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ACBD4(acyl-Coenzyme A binding domain containing 4) The peptide sequence was selected from the N terminal of ACBD4. Peptide sequence MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQAT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACBD4
Conjugate Unconjugated
Supplier Page Shop

Product images