PRRG3 Antibody

Name PRRG3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59992
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Bovine, Dog, Horse, Guinea Pig
Antigen Synthetic peptides corresponding to PRRG3(proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane)) The peptide sequence was selected from the N terminal of PRRG3. Peptide sequence EEICSYEEVKEVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMYVVVPLL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PRRG3
Supplier Page Shop

Product images