APMAP Antibody

Name APMAP Antibody
Supplier Novus Biologicals
Catalog NBP1-59984
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C20ORF3 The peptide sequence was selected from the C terminal of C20ORF3 (NP_065392). Peptide sequence QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene APMAP
Conjugate Unconjugated
Supplier Page Shop

Product images