TMCO1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59980
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to TMCO1(transmembrane and coiled-coil domains 1) The peptide sequence was selected from the C terminal of TMCO1. Peptide sequence CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: TMCO1
• Conjugate: Unconjugated