C5orf4 Antibody
| Name | C5orf4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60125 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C5ORF4 The peptide sequence was selected from the N terminal of C5ORF4. Peptide sequence MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FAXDC2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C5orf4 Antibody [NBP1-60125] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24189_C5orf4-Antibody-Western-Blot-NBP1-60125-img0001.jpg)
Western Blot: C5orf4 Antibody [NBP1-60125] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: C5orf4 Antibody [NBP1-60125] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24190_C5orf4-Antibody-Immunohistochemistry-Paraffin-NBP1-60125-img0003.jpg)
Immunohistochemistry-Paraffin: C5orf4 Antibody [NBP1-60125] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.