ZDHHC18 Antibody

Name ZDHHC18 Antibody
Supplier Novus Biologicals
Catalog NBP1-60116
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to ZDHHC18 (zinc finger, DHHC-type containing 18) The peptide sequence was selected from the middle region of ZDHHC18. Peptide sequence FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSII.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ZDHHC18
Supplier Page Shop

Product images