Cadherin-22 Antibody

Name Cadherin-22 Antibody
Supplier Novus Biologicals
Catalog NBP1-60069
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CDH22(cadherin-like 22) The peptide sequence was selected from the N terminal of CDH22. Peptide sequence LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene CDH22
Conjugate Unconjugated
Supplier Page Shop

Product images