ST3GAL3 Antibody
| Name | ST3GAL3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60067 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ST3GAL3(ST3 beta-galactoside alpha-2,3-sialyltransferase 3) The peptide sequence was selected from the C terminal of ST3GAL3. Peptide sequence GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | ST3GAL3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ST3GAL3 Antibody [NBP1-60067] - Human Muscle lysate, concentration 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24252_ST3GAL3%2520Antibody-Western%2520Blot-NBP1-60067-img0002.jpg)
Western Blot: ST3GAL3 Antibody [NBP1-60067] - Human Muscle lysate, concentration 1.25ug/ml.