Pipecolic acid oxidase Antibody

Name Pipecolic acid oxidase Antibody
Supplier Novus Biologicals
Catalog NBP1-60060
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PIPOX(pipecolic acid oxidase) The peptide sequence was selected from the C terminal of PIPOX. Peptide sequence FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PIPOX
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.