Name | MAN1A2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-60058 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to MAN1A2(mannosidase, alpha, class 1A, member 2) The peptide sequence was selected from the middle region of MAN1A2. Peptide sequence FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | MAN1A2 |
Conjugate | Unconjugated |
Supplier Page | Shop |