MAN1A2 Antibody

Name MAN1A2 Antibody
Supplier Novus Biologicals
Catalog NBP1-60058
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MAN1A2(mannosidase, alpha, class 1A, member 2) The peptide sequence was selected from the middle region of MAN1A2. Peptide sequence FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MAN1A2
Conjugate Unconjugated
Supplier Page Shop

Product images