PEX10 Antibody

Name PEX10 Antibody
Supplier Novus Biologicals
Catalog NBP1-60050
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PEX10(peroxisome biogenesis factor 10) The peptide sequence was selected from the C terminal of PEX10. Peptide sequence ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PEX10
Conjugate Unconjugated
Supplier Page Shop

Product images