GOLGA5 Antibody
| Name | GOLGA5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60047 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GOLGA5(golgi autoantigen, golgin subfamily a, 5) The peptide sequence was selected from the N terminal of GOLGA5. Peptide sequence FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GOLGA5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GOLGA5 Antibody [NBP1-60047] - Human 293T, Antibody Dilution: 1.0 ug/ml GOLGA5 is supported by BioGPS gene expression data to be expressed in HEK293T.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6905_GOLGA5%2520Antibody-Western%2520Blot-NBP1-60047-img0003.jpg)
![Western Blot: GOLGA5 Antibody [NBP1-60047] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6906_GOLGA5-Antibody-Western-Blot-NBP1-60047-img0002.jpg)