ZDHHC14 Antibody

Name ZDHHC14 Antibody
Supplier Novus Biologicals
Catalog NBP1-60110
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZDHHC14(zinc finger, DHHC-type containing 14) The peptide sequence was selected from the N terminal of ZDHHC14. Peptide sequence TLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVII.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZDHHC14
Conjugate Unconjugated
Supplier Page Shop

Product images