NETO2 Antibody

Name NETO2 Antibody
Supplier Novus Biologicals
Catalog NBP1-62427
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NETO2(neuropilin (NRP) and tolloid (TLL)-like 2) The peptide sequence was selected from the N terminal of NETO2 (NP_060562). GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NETO2
Conjugate Unconjugated
Supplier Page Shop

Product images