Name | NETO2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62427 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to NETO2(neuropilin (NRP) and tolloid (TLL)-like 2) The peptide sequence was selected from the N terminal of NETO2 (NP_060562). GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | NETO2 |
Conjugate | Unconjugated |
Supplier Page | Shop |