REEP1 Antibody

Name REEP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-62374
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to REEP1(receptor accessory protein 1) The peptide sequence was selected from the middle region of REEP1. Peptide sequence AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene REEP1
Conjugate Unconjugated
Supplier Page Shop

Product images