Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-62370
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CHST1(carbohydrate (keratan sulfate Gal-6) sulfotransferase 1) The peptide sequence was selected from the middle region of CHST1. Peptide sequence YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CHST1
• Conjugate: Unconjugated

Product images

Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370] - Human kidney lysate, concentration 0.2-1 ug/ml.

Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.