Name | C1qTNF1/CTRP1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62296 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to C1QTNF1(C1q and tumor necrosis factor related protein 1) The peptide sequence was selected from the N terminal of C1QTNF1. Peptide sequence YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | C1QTNF1 |
Supplier Page | Shop |