C1qTNF1/CTRP1 Antibody

Name C1qTNF1/CTRP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-62296
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to C1QTNF1(C1q and tumor necrosis factor related protein 1) The peptide sequence was selected from the N terminal of C1QTNF1. Peptide sequence YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene C1QTNF1
Supplier Page Shop

Product images