PQLC1 Antibody

Name PQLC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-62482
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PQLC1(PQ loop repeat containing 1) The peptide sequence was selected from the middle region of PQLC1. Peptide sequence TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PQLC1
Conjugate Unconjugated
Supplier Page Shop

Product images