PIGO Antibody

Name PIGO Antibody
Supplier Novus Biologicals
Catalog NBP1-62446
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PIGO(phosphatidylinositol glycan anchor biosynthesis, class O) The peptide sequence was selected from the N terminal of PIGO. Peptide sequence LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PIGO
Conjugate Unconjugated
Supplier Page Shop

Product images