SAPS1 Antibody

Name SAPS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57815
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PPP6R1 (protein phosphatase 6, regulatory subunit 1) Antibody(against the N terminal of PPP6R1. Peptide sequence MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PPP6R1
Conjugate Unconjugated
Supplier Page Shop

Product images