Name | HspA4L Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57695 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to HSPA4L(heat shock 70kDa protein 4-like) The peptide sequence was selected from the C terminal of HSPA4L. Peptide sequence KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | HSPA4L |
Conjugate | Unconjugated |
Supplier Page | Shop |