HspA4L Antibody

Name HspA4L Antibody
Supplier Novus Biologicals
Catalog NBP1-57695
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HSPA4L(heat shock 70kDa protein 4-like) The peptide sequence was selected from the C terminal of HSPA4L. Peptide sequence KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HSPA4L
Conjugate Unconjugated
Supplier Page Shop

Product images