ATAT1 Antibody

Name ATAT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57690
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATAT1. The peptide sequence was selected from the N terminal of ATAT1 (NP_079185). Peptide sequence MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ATAT1
Conjugate Unconjugated
Supplier Page Shop

Product images