ATAT1 Antibody

Name ATAT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57667
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to C6orf134 (chromosome 6 open reading frame 134) The peptide sequence was selected from the N terminal of C6orf134)(50ug). Peptide sequence MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ATAT1
Supplier Page Shop

Product images