TBC1D16 Antibody

Name TBC1D16 Antibody
Supplier Novus Biologicals
Catalog NBP1-57666
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TBC1D16 (TBC1 domain family, member 16) The peptide sequence was selected from the N terminal of TBC1D16)(50ug). Peptide sequence EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TBC1D16
Conjugate Unconjugated
Supplier Page Shop

Product images