Carboxypeptidase X1/CPXM1 Antibody
| Name | Carboxypeptidase X1/CPXM1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57725 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CPXM1 (carboxypeptidase X (M14 family), member 1) The peptide sequence was selected from the middle region of CPXM1)(50ug). Peptide sequence MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CPXM1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Carboxypeptidase X1/CPXM1 Antibody [NBP1-57725] - Human Lung lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16371_Carboxypeptidase-X1-CPXM1-Antibody-Western-Blot-NBP1-57725-img0003.jpg)
Western Blot: Carboxypeptidase X1/CPXM1 Antibody [NBP1-57725] - Human Lung lysate, concentration 0.2-1 ug/ml.