KCTD16 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57708
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to KCTD16 (potassium channel tetramerisation domain containing 16) The peptide sequence was selected from the N terminal of KCTD16. Peptide sequence KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: KCTD16
• Conjugate: Unconjugated