TINAGL1 Antibody

Name TINAGL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57707
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TINAGL1 (tubulointerstitial nephritis antigen-like 1) The peptide sequence was selected from the middle region of TINAGL1. Peptide sequence ENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TINAGL1
Conjugate Unconjugated
Supplier Page Shop

Product images