CLPB Antibody

Name CLPB Antibody
Supplier Novus Biologicals
Catalog NBP1-57703
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CLPB(ClpB caseinolytic peptidase B homolog (E. coli)) The peptide sequence was selected from the middle region of CLPB. Peptide sequence ELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLPB
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.