CLPB Antibody

Name CLPB Antibody
Supplier Novus Biologicals
Catalog NBP1-57702
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit
Antigen Synthetic peptides corresponding to CLPB(ClpB caseinolytic peptidase B homolog (E. coli)) The peptide sequence was selected from the N terminal of CLPB. Peptide sequence QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CLPB
Supplier Page Shop

Product images